PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g001690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 554aa    MW: 60522.8 Da    PI: 7.2066
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g001690.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.3e-10406462561
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                     kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++
  Csa12g001690.1 406 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQRDMIGLTN 462
                     899*****************************************9999877665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-19402466IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.68404467IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-11406462No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-11406463No hitNo description
PfamPF001701.3E-8406457IPR004827Basic-leucine zipper domain
CDDcd147033.61E-24407456No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MGDTEKCSNT TDHMIHRLHS SFGTSSSSIP KHATTAPIHH QQQKQLDLNP NLLRSSTTPQ  60
FPQFSNCAKR IGVPPSHPNL IPPPTSPFSQ IPTSRQTPSL HSHSRSLSQP NSFFSFDSLP  120
PLSPSPFRDS LSSSAAAQLP DHDVSMEDPP DSAAFSSPFT RCNNSTSSVR AGESLPPRKS  180
HRRSSSDIPT GFNNNSLPPR PLERSFSGGE CADWSKSAPF VKKESSCDKE GVGDREAMDD  240
LFSAYMNLEN IDVLNSSEAE DSKNGGGTNN NENRDDMDSS RASGTKTNNG SSDTEGETSS  300
VNESANTGGV KRRAAGGDIA PTTRHYRSVS VDSCFMDKFS FGDESLKPPL SPGTISRKVS  360
PTNSVDGNSG AAAFSIEFKN GEFTAAEMKK IMANDKLAEM AMSDPKRVKR ILANRQSAAR  420
SKERKMRYIV ELEHKVQTLQ TEATTLSAQL TLLQRDMIGL TNQNNELKFR LQAMEQQARL  480
RDALNEALNG EVQRLKLAIG ETSHNESERS KMQSLNAEMF QQLNISQLRQ QPQQSQQNQN  540
GTMALATKPE SNE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808390.0AY080839.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
GenBankAY1504350.0AY150435.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010446403.10.0PREDICTED: transcription factor RF2a-like
TrEMBLQ8H1F00.0Q8H1F0_ARATH; Basic-leucine zipper (BZIP) transcription factor family protein
STRINGAT4G38900.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.30.0bZIP family protein